PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J00957.1.p
Common NameEUGRSUZ_J00957, LOC104421692
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 300aa    MW: 32443 Da    PI: 7.4465
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J00957.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1282.7e-403596263
            zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                      +e+alkcprCdstntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rkn++sss
  Eucgr.J00957.1.p 35 PEQALKCPRCDSTNTKFCYYNNYSLSQPRYFCKSCRRYWTKGGTLRNVPVGGGCRKNRRSSS 96
                      7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-303393IPR003851Zinc finger, Dof-type
PfamPF027019.6E-343793IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.5813993IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104177IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MDSSGVQHQE MSGSLESMLV CTKPQQDNKK PRPQPEQALK CPRCDSTNTK FCYYNNYSLS  60
QPRYFCKSCR RYWTKGGTLR NVPVGGGCRK NRRSSSSSSS SSKRAQDQQL LTSSANSVLN  120
GLPGLSTFDS SDLTLAFARL QKQASGQFGL DDHDLPILGK PNIHPSDVLG NHGGFLDSLR  180
HGFIESHQGN FQNFYYGHGG ANAGDLMENG CGAGEMGLGY DQEMSGPQTT AAVTMTTMKQ  240
ELCSGGEGEN RILWGFPWQL NANYADGGNM MGELDSARGS GWSNGLSSPW HGLLNSPLM*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J00957.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9475242e-35EU947524.1 Zea mays clone 346044 mRNA sequence.
GenBankKJ7269772e-35KJ726977.1 Zea mays clone pUT3678 C2C2-DOF transcription factor (DOF32) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010032040.10.0PREDICTED: dof zinc finger protein DOF5.3
TrEMBLA0A059ABJ30.0A0A059ABJ3_EUCGR; Uncharacterized protein
STRINGGLYMA12G07710.11e-114(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM69602743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28510.11e-45Dof family protein